PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen10g036050.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 256aa    MW: 29199 Da    PI: 8.2418
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen10g036050.2genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.18e-101531852254
                       SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       ++yp+ +++  LAk++gL+ +qV++WF N R +
  Sopen10g036050.2 153 HPYPTDSDKIMLAKQTGLSRNQVSNWFINARVR 185
                       89*****************************87 PP

2BELL72.95.3e-2441107272
              BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       ++e+ +  +k +s+l+eV++rYk y+eqlq v+ssFe vag+g+    ++l lka+ +hFrcL   i++q+
  Sopen10g036050.2  41 NHEHMRNNSKFISMLDEVYRRYKEYYEQLQGVVSSFESVAGVGN----ANLSLKALCKHFRCLIKSICDQM 107
                       57888999************************************....689*****************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.8E-66105IPR006563POX domain
PfamPF075261.8E-1934103IPR006563POX domain
PROSITE profilePS5007111.791126189IPR001356Homeobox domain
SMARTSM003891.3E-9129193IPR001356Homeobox domain
CDDcd000868.63E-12129190No hitNo description
SuperFamilySSF466891.92E-17131197IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-28132193IPR009057Homeodomain-like
PfamPF059202.6E-19146185IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MSHNKAEEIS LELMQDISGI YAHKLLQDHH HSLGTMDDVS NHEHMRNNSK FISMLDEVYR  60
RYKEYYEQLQ GVVSSFESVA GVGNANLSLK ALCKHFRCLI KSICDQMKSS EINCDGNVCN  120
NLERGGYVWR PQRGLPERAV TLLRAWLFDH FLHPYPTDSD KIMLAKQTGL SRNQVSNWFI  180
NARVRVWKPM VEEIHMLENN KSSSQAQNNN NPEMNLSSSG GVSLTLGLNH QNKNNALSFP  240
RNAARRFGID PNNIIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A1e-16135193563Homeobox protein Meis2
4xrm_B1e-16135193563Homeobox protein Meis2
5bng_A2e-16135193159Homeobox protein Meis2
5bng_B2e-16135193159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754491e-162HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015089274.10.0PREDICTED: BEL1-like homeodomain protein 9 isoform X2
SwissprotQ9LZM84e-69BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLK4D4951e-167K4D495_SOLLC; Uncharacterized protein
STRINGSolyc10g086640.1.11e-167(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-69TALE family protein